Lab77 Peptides: Cagrilintide (Lyophilized Powder)
Non-Selective Amylin (AMYR) & Calcitonin Receptor Agonist for Advanced Satiety and Metabolic Research
Lab77 Peptides Cagrilintide is an analytical-grade, long-acting acylated amylin analogue designed specifically for cellular signaling assays, neuro-metabolic modeling, and dual-pathway obesity research. Synthesized via Solid-Phase Peptide Synthesis (SPPS), this non-selective amylin receptor (AMYR) and calcitonin G protein-coupled receptor (CTR) agonist mimics endogenous amylin signaling to regulate gastric emptying kinetics, central satiety pathways, and lipid turnover.
When acquiring a cagrilintide research peptide UK laboratories require for repeatable, high-throughput assays, sequence purity and structural stability are critical. Every lot of Lab77 cagrilintide UK stock undergoes independent third-party audits to confirm precise molecular mass, sequence identity, and quantitative vial content.
Technical Specifications & Chemical Profile
| Technical Parameter | Specification Standard |
| Chemical Name | Cagrilintide (Acylated Amylin Analogue) |
| Sequence Backbone | KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2 (Disulfide Bridge: Cys3-Cys8) |
| CAS Registry Number | 1415456-99-3 |
| Molecular Formula | $\text{C}_{194}\text{H}_{312}\text{N}_{54}\text{O}_{59}\text{S}_2$ |
| Molecular Weight | $\sim 4409.01 \text{ g/mol}$ |
| Purity Grade | $\ge 98\%$ (HPLC Verified) |
| Physical Appearance | Lyophilized White Powder (Vacuum Sealed) |
| Storage Standard | Desiccated at $-20^\circ\text{C}$ (Shield from ambient moisture and light) |
Key Scientific Research Applications | Lab77 Peptides Cagrilintide
Cagrilintide is a major focal point in metabolic life science research due to its ability to engage amylin and calcitonin receptors simultaneously without relying solely on classical incretin pathways.
Researchers utilizing cagrilintide peptide UK compounds focus on core analytical vectors, including:
-
Synergistic Dual-Agonism: Investigating co-formulation kinetics alongside GLP-1 or dual GIP/GLP-1 analogues (e.g., CagriSema co-administration models).
-
Centrally-Mediated Satiety Signaling: Mapping AMYR receptor binding in the area postrema and hypothalamus to evaluate appetite regulation pathways.
-
Gastric Emptying Delay: Measuring delayed gastric motility and postprandial glucose damping in cell culture and tissue models.
Analytical Verification: Janoshik Tested & Certified
To safeguard your laboratory assays against sequence truncation artifacts or solvent residues, every batch of our cagrilintide peptide UK stock is audited independently by Janoshik Analytical.
[ Solid-Phase Synthesis ] ──► [ Independent Janoshik Audit ] ──► [ Verified COA Released ]
Verified Batch Metrics:
-
High-Performance Liquid Chromatography (HPLC): Guarantees sequence purity ($\ge 98\%$), confirming the absence of unreacted peptide chains.
-
Mass Spectrometry (MS): Validates precise molecular mass ($\sim 4409.01 \text{ Da}$) and disulfide bridge formation.
-
Quantity Auditing: Verifies exact milligram mass per vial to eliminate micro-dosing variances during assay preparation.
Verify Your Batch: Each vial includes a unique batch code. Access our [Janoshik COA Verification Portal] to view original HPLC chromatograms and mass spectra prior to laboratory reconstitution.
Reconstitution & Handling Guidance | Lab77 Peptides Cagrilintide
-
Reconstitution Media: Reconstitute using sterile, laboratory-grade Bacteriostatic Water or standard pH-balanced buffers.
-
Solubility Protocol: Allow the vial to reach room temperature before solvent introduction. Gently swirl the vial to dissolve the lyophilized cake—avoid violent agitation or vortexing to preserve peptide structural integrity.
-
Storage Protocol: Store unopened lyophilized vials desiccated at $-20^\circ\text{C}$. After reconstitution, maintain liquid stock solutions at $2^\circ\text{C}$ to $8^\circ\text{C}$ and utilize within your laboratory’s designated testing timeframe.
Why Source Cagrilintide from Lab77 Peptides UK?
-
Direct UK Inventory: Domestic dispatch eliminates border holds, customs checks, and transit-related temperature exposure.
-
Full Batch Traceability: Every lot is directly linked to an unaltered, public Certificate of Analysis (COA).
-
Strict Research-Grade Mandate: Specialized synthesis tailored exclusively for life science research, academic institutions, and analytical laboratories.
-
[Add Cagrilintide Vial to Cart] (Internal Link to Product Checkout)
-
[View Research Injector Pens & Accessories] (Internal Link to Hardware Category)
-
[Access Janoshik COA Lookup Portal] (Internal Link to Verification Portal)
Compliance Disclaimer
This product is supplied strictly for in-vitro research, laboratory experimentation, and scientific analytical use. It is not a drug, biological product, or medical agent, nor is it intended or approved for human consumption, clinical trials, or therapeutic administration.
Reviews
There are no reviews yet.